Curated Sample Data


Genome
ce10
Antigen Class
TFs and others
Antigen
kle-2
Cell type Class
Larvae
Cell type
L3

Cell type information


NA
NA

Attributes by Original Data Submitter


source_name
whole worms
strain
N2
developmental stage
L3
matching input
Input_N2_L3_Rep2
antibody
KLE-2 SDQ3942 Rabbit polyclonal is against the antigen MTRNAPPGQESTDLAWLVTPAKDLVENFSIDVLKALAGYLEVIRQESEDTDNQVDAATTYRLFDFQRACRIIQGSCAVYGRKVDHVYELTISVVDLVENK May be available as part of modENCODE antibodies from Novus Biologicals "http://www.novusbio.com/"

Metadata from Sequence Read Archive

Library Description


library_strategy
ChIP-Seq
library_source
GENOMIC
library_selection
ChIP
library_construction_protocol
Frozen Larva were broken into pieces using cryo-mixer mill, and crosslinked with 1% formaldehyde for 10 minutes. The worms were collected by centrifugation, were washed with and dounced in FA buffer (50 mM HEPES/KOH pH 7.5, 1 mM EDTA, 1% Triton X-100, 0.1 % sodium deoxycholate; 150 mM NaCl). 0.1 sarkosyl was added before sonicating to obtain chromatin fragments of majority between 200-800 bp. 1-2 mg of larva extract and 3-5 ug of antibody was used per ChIP. Half of the ChIP DNA were ligated to Illumina or home-made multiplexed adapters and amplified by PCR. Library DNA between 250-500 bp in size was gel purified.

Platform Information


instrument_model
Illumina HiSeq 2000

External Database Query

Logs in read processing pipeline


Number of total reads
7074941
Reads aligned (%)
93.0
Duplicates removed (%)
27.7
Number of peaks
2610 (qval < 1E-05)

Sequence Quality Data from DBCLS SRA