Sample information curated by ChIP-Atlas

Antigen

Antigen Class
TFs and others
Antigen
kle-2

Cell type

Cell type Class
Embryo
Cell type
Embryos
NA
NA

Attributes by original data submitter

Sample

source_name
whole worms
strain
TY1072
developmental stage
embryo
matching input
Input_TY1072_MxEmb_Rep20
antibody
KLE-2 SDQ3942 Rabbit polyclonal is against the antigen MTRNAPPGQESTDLAWLVTPAKDLVENFSIDVLKALAGYLEVIRQESEDTDNQVDAATTYRLFDFQRACRIIQGSCAVYGRKVDHVYELTISVVDLVENK May be available as part of modENCODE antibodies from Novus Biologicals "http://www.novusbio.com/"

Sequenced DNA Library

library_strategy
ChIP-Seq
library_source
GENOMIC
library_selection
ChIP
library_construction_protocol
Embryos were washed and dounced in FA buffer (50 mM HEPES/KOH pH 7.5, 1 mM EDTA, 1% Triton X-100, 0.1 % sodium deoxycholate; 150 mM NaCl). 0.1 sarkosyl was added before sonicating to obtain chromatin fragments of majority between 200-800 bp. 1-2 mg of embryo extract and 3-5 ug of antibody was used per ChIP. Half of the ChIP DNA were ligated to Illumina or home-made multiplexed adapters and amplified by PCR. Library DNA between 250-500 bp in size was gel purified.

Sequencing Platform

instrument_model
Illumina HiSeq 2000

ce10

Number of total reads
6913957
Reads aligned (%)
61.1
Duplicates removed (%)
7.1
Number of peaks
564 (qval < 1E-05)

ce11

Number of total reads
6913957
Reads aligned (%)
61.1
Duplicates removed (%)
7.1
Number of peaks
564 (qval < 1E-05)

Base call quality data from DBCLS SRA