Sample information curated by ChIP-Atlas

Antigen

Antigen Class
TFs and others
Antigen
pqn-85

Cell type

Cell type Class
Embryo
Cell type
Embryos
NA
NA

Attributes by original data submitter

Sample

source_name
whole worms
strain
TY1072
developmental stage
embryo
matching input
Input_TY1072_MxEmb_Rep19
antibody
PQN-85 SDQ4481 Rabbit polyclonal is against the antigen QQQPVQQIQRQQPIAQPIPQHTIPPSTSNQFQQQIQSAASSIFDSSVISSHQKLYEEQCRQIEKERKEQEERKRKQELEEQRKRNEELKRLRIAEEKRLL May be available as part of modENCODE antibodies from Novus Biologicals "http://www.novusbio.com/"

Sequenced DNA Library

library_strategy
ChIP-Seq
library_source
GENOMIC
library_selection
ChIP

Sequencing Platform

instrument_model
Illumina HiSeq 2000

ce10

Number of total reads
14843156
Reads aligned (%)
85.0
Duplicates removed (%)
10.2
Number of peaks
775 (qval < 1E-05)

ce11

Number of total reads
14843156
Reads aligned (%)
85.0
Duplicates removed (%)
10.2
Number of peaks
771 (qval < 1E-05)

Base call quality data from DBCLS SRA