Sample information curated by ChIP-Atlas

Antigen

Antigen Class
TFs and others
Antigen
mix-1

Cell type

Cell type Class
Embryo
Cell type
Embryos
NA
NA

Attributes by original data submitter

Sample

source_name
whole worms
strain
N2
developmental stage
embryo
matching input
Input_N2_MxEmb_Rep7
antibody
MIX-1 SDQ4107 Rabbit polyclonal is against the antigen MHIKSIHLDGFKSYQKHTDILDFSPTFNAITGYNGSGKSNILDSICFIMGINKLDNIRAKSMHELISHGGTKAIVQVRFDNTDKRCSPFGMEHLDEIVVQ. May be available as part of modENCODE antibodies from Novus Biologicals "http://www.novusbio.com/"

Sequenced DNA Library

library_name
ERROR: cannot retrieve data from NCBI: too many requests
library_strategy
ERROR: cannot retrieve data from NCBI: too many requests
library_source
ERROR: cannot retrieve data from NCBI: too many requests
library_selection
ERROR: cannot retrieve data from NCBI: too many requests
library_construction_protocol
ERROR: cannot retrieve data from NCBI: too many requests

Sequencing Platform

instrument_model
ERROR: cannot retrieve data from NCBI: too many requests
cycle_sequence
ERROR: cannot retrieve data from NCBI: too many requests
cycle_count
ERROR: cannot retrieve data from NCBI: too many requests
flow_sequence
ERROR: cannot retrieve data from NCBI: too many requests
flow_count
ERROR: cannot retrieve data from NCBI: too many requests
key_sequence
ERROR: cannot retrieve data from NCBI: too many requests

ce10

Number of total reads
6618120
Reads aligned (%)
51.1
Duplicates removed (%)
47.2
Number of peaks
591 (qval < 1E-05)

ce11

Number of total reads
6618120
Reads aligned (%)
51.1
Duplicates removed (%)
47.2
Number of peaks
591 (qval < 1E-05)

Base call quality data from DBCLS SRA