Sample information curated by ChIP-Atlas

Antigen

Antigen Class
TFs and others
Antigen
dpy-28

Cell type

Cell type Class
Embryo
Cell type
Embryos
NA
NA

Attributes by original data submitter

Sample

source_name
whole worms
strain
N2
developmental stage
embryo
matching input
Input_N2_MxEmb_Rep11
antibody
DPY-28 SDQ4564 Rabbit polyclonal is against the antigen QQQPTRNNDGLSGFKSITEIIAEADNNIPSEQIDKDIDSFSSYSDISDWRGIPKFFPSLSSLSRRASTYENWENRFKVVDYLVSCSGALKDSVSDYVADY May be available as part of modENCODE antibodies from Novus Biologicals "http://www.novusbio.com/"

Sequenced DNA Library

library_strategy
ChIP-Seq
library_source
GENOMIC
library_selection
ChIP

Sequencing Platform

instrument_model
Illumina HiSeq 2000

ce10

Number of total reads
20920487
Reads aligned (%)
53.1
Duplicates removed (%)
45.0
Number of peaks
1258 (qval < 1E-05)

ce11

Number of total reads
20920487
Reads aligned (%)
53.1
Duplicates removed (%)
45.0
Number of peaks
1256 (qval < 1E-05)

Base call quality data from DBCLS SRA