Sample information curated by ChIP-Atlas

Antigen

Antigen Class
TFs and others
Antigen
capg-2

Cell type

Cell type Class
Embryo
Cell type
Embryos
NA
NA

Attributes by original data submitter

Sample

source_name
whole worms
strain
N2
developmental stage
embryo
matching input
Input_N2_MxEmb_Rep15
antibody
CAPG-2 SDQ4567 Rabbit polyclonal to 808-907 aa is against the antigen IPKWMNKQCDLMEDDEENIFKNHREIVESLRQFHKRVSETDYWDEDSAKRMMHHFMLFSIVSASSKNDDEAYDDPRDEDYKPPHFISLALIKFILKEKSL May be available as part of modENCODE antibodies from Novus Biologicals "http://www.novusbio.com/"

Sequenced DNA Library

library_strategy
ChIP-Seq
library_source
GENOMIC
library_selection
ChIP

Sequencing Platform

instrument_model
Illumina HiSeq 2000

ce10

Number of total reads
18816016
Reads aligned (%)
32.8
Duplicates removed (%)
66.7
Number of peaks
1135 (qval < 1E-05)

ce11

Number of total reads
18816016
Reads aligned (%)
32.8
Duplicates removed (%)
66.7
Number of peaks
1135 (qval < 1E-05)

Base call quality data from DBCLS SRA