Sample information curated by ChIP-Atlas


Antigen Class
TFs and others

Cell type

Cell type Class
Cell type

Attributes by original data submitter


whole worms
developmental stage
matching input
CAPG-2 SDQ4484 Rabbit polyclonal to 808-907 aa is against the antigen IPKWMNKQCDLMEDDEENIFKNHREIVESLRQFHKRVSETDYWDEDSAKRMMHHFMLFSIVSASSKNDDEAYDDPRDEDYKPPHFISLALIKFILKEKSL May be available as part of modENCODE antibodies from Novus Biologicals ""

Sequenced DNA Library


Sequencing Platform

Illumina HiSeq 2000


Number of total reads
Reads aligned (%)
Duplicates removed (%)
Number of peaks
937 (qval < 1E-05)


Number of total reads
Reads aligned (%)
Duplicates removed (%)
Number of peaks
936 (qval < 1E-05)

Base call quality data from DBCLS SRA