Curated Sample Data


Genome
ce10
Antigen Class
TFs and others
Antigen
capg-1
Cell type Class
Embryo
Cell type
Embryos

Cell type information


NA
NA

Attributes by Original Data Submitter


source_name
whole worms
strain
N2
developmental stage
embryo
matching input
Input_N2_MxEmb_Rep4
antibody
CAPG-1 SDQ3967 Rabbit polyclonal is against the antigen MPPKKRIRGPKLPALREEKSTGTDVASDESFNESADFLNNEELNNDQNDAENTVLSEGVSTLRINENMTKEDRACISAALFIKKRVVESIRTVFQSRDDI May be available as part of modENCODE antibodies from Novus Biologicals "http://www.novusbio.com/"

Metadata from Sequence Read Archive

Library Description


library_strategy
ChIP-Seq
library_source
GENOMIC
library_selection
ChIP

Platform Information


instrument_model
Illumina Genome Analyzer IIx

External Database Query

Logs in read processing pipeline


Number of total reads
8060704
Reads aligned (%)
96.6
Duplicates removed (%)
29.8
Number of peaks
3317 (qval < 1E-05)

Sequence Quality Data from DBCLS SRA